PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_009302-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 286aa    MW: 32490.8 Da    PI: 6.6713
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_009302-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-143782148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  AHYPO_009302-RA 37 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 82
                     89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.252131IPR017877Myb-like domain
SuperFamilySSF466895.99E-211791IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.6E-101742IPR009057Homeodomain-like
PROSITE profilePS5129423.0443286IPR017930Myb domain
SMARTSM007173.5E-133684IPR001005SANT/Myb domain
PfamPF002494.6E-133782IPR001005SANT/Myb domain
CDDcd001677.35E-93982No hitNo description
Gene3DG3DSA:1.10.10.601.3E-204387IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGRPPCCDKD GIKKGLQRCS KSCRLRWTNY LRPGIKRGNF TPHEEGMIIH LQALLGNKWA  60
AIASYLPQRT DNDIKNYWNT HLKKKLKRFQ STFQPDPQSS NATTSSSSSP NSKSMNEDHS  120
FHHNNMVIPT QPSSSTSTST SASTCYASST ENISRLLESW MKYSPTSKTK LITSDNHDYN  180
YNNNNNQNDT NHNDSFFGED PENQFKSILS FDNLLNNKVV VTTIGDSNED DTNEEVEKEC  240
DKNMDKINDH DQSNPPLTFL EKWLLDESTT SRHVAEEILR LPSIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-16188640108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010677865.11e-109PREDICTED: myb-related protein 306 isoform X2
TrEMBLA0A0J8CGV41e-109A0A0J8CGV4_BETVU; Uncharacterized protein
STRINGPOPTR_0013s06390.16e-81(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.11e-59myb domain protein 60